Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against TRPV5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SHRGWEILRQNT, from the internal region of the protein sequence according to NP_062815.2. |
Antibodies
View as table Download
Rabbit polyclonal Anti-TRPV5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPV5 antibody: synthetic peptide directed towards the N terminal of human TRPV5. Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA |
TRPV5 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 633-663 amino acids from the C-terminal region of human TRPV5 |
TRPV5 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRPV5 |
TRPV5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-325 of human TRPV5 (NP_062815.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TRPV5