Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TYK2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TYK2 Antibody: A synthesized peptide derived from human TYK2 |
Rabbit anti-TYK2 (Phospho-Tyr1054) polyclonal antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanTYK2 around the phosphorylation site of tyrosine 1054 (H-E-YP-Y-R). |
| Modifications | Phospho-specific |
Anti-TYK2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human tyrosine kinase 2 |
Rabbit Polyclonal TYK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal TYK2 antibody was raised against a 17 amino acid peptide near the amino terminus of human TYK2. |
Rabbit Polyclonal anti-TYK2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TYK2 antibody: synthetic peptide directed towards the C terminal of human TYK2. Synthetic peptide located within the following region: HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAP |
Phospho-TYK2-Y1054 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1054 of human TYK2 |
| Modifications | Phospho-specific |
TYK2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TYK2 |
TYK2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TYK2 |
TYK2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 750-850 of human TYK2 (NP_003322.3). |
| Modifications | Unmodified |
Phospho-Tyk2-Y1054/1055 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around Y1054 & Y1055 of human Tyk2 (NP_003322.3). |
| Modifications | Phospho Y1054/1055 |
Phospho-Tyk2-Y292 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around Y292 of human Tyk2 (NP_003322.3). |
| Modifications | Phospho Y292 |
Active filters
Target Symbol
- TYK2