Germany
Japan
United Kingdom
China
Rabbit Polyclonal WDFY3 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-WDFY3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDFY3 antibody: synthetic peptide directed towards the middle region of human WDFY3. Synthetic peptide located within the following region: LEVMVNLLHKYAALLKDPTQALNEQGDSRNNSSVEDQKHLALLVMETLTV |
Rabbit Polyclonal Anti-WDFY3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WDFY3 antibody: synthetic peptide directed towards the C terminal of human WDFY3. Synthetic peptide located within the following region: EKLADAVRFLGCFSDLRKISAMNVFPSNTQPFQRLLEEDVISIESVSPTL |
Goat Anti-Alfy / WDFY3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SPERSTRTQQKEFQT, from the internal region of the protein sequence according to NP_055806.2. |
WDFY3 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human WDFY3 |
Active filters
Target Symbol
- WDFY3