WDFY3 Rabbit Polyclonal Antibody

CAT#: TA339825

Rabbit Polyclonal Anti-WDFY3 Antibody

Product Images

WB Suggested Anti-WDFY3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WDFY3 antibody: synthetic peptide directed towards the middle region of human WDFY3. Synthetic peptide located within the following region: LEVMVNLLHKYAALLKDPTQALNEQGDSRNNSSVEDQKHLALLVMETLTV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 90 kDa
• Gene Name: WD repeat and FYVE domain containing 3
• Database Link:
  NP_848698
  Entrez Gene 23001 Human
  UniProt ID Q8IZQ1
• Background: WDFY3 is a protein which contains WD repeats and an FYVE domain. WDFY3 might target cytosolic protein aggregates for autophagic degradation.Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.This gene encodes a protein which contains WD repeats and an FYVE domain. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
• Synonyms: ALFY; KIAA0993; MGC16461; WD repeat and FYVE domain containing 3; ZFYVE25
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%