Germany
Japan
United Kingdom
China
ZKSCAN1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZKSCAN1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Zkscan1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Zkscan1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YECNECGKAFSQSSDLTKHQRIHTGEKPYECSECGKAFNRNSYLILHRRI |
Rabbit Polyclonal Anti-ZKSCAN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZKSCAN1 antibody: synthetic peptide directed towards the N terminal of human ZKSCAN1. Synthetic peptide located within the following region: NTKEQILELLVLEQFLSILPKELQVWLQEYRPDSGEEAVTLLEDLELDLS |
Rabbit Polyclonal Anti-ZKSCAN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZKSCAN1 antibody: synthetic peptide directed towards the middle region of human ZKSCAN1. Synthetic peptide located within the following region: EKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSLSSNFTTPEEVPTGTK |
Carrier-free (BSA/glycerol-free) ZKSCAN1 mouse monoclonal antibody,clone OTI6D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ZKSCAN1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZKSCAN1 |
ZKSCAN1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-230 of human ZKSCAN1 (NP_003430.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
ZKSCAN1 mouse monoclonal antibody,clone OTI6D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZKSCAN1 mouse monoclonal antibody,clone OTI6D11, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ZKSCAN1 mouse monoclonal antibody,clone OTI6D11, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ZKSCAN1 mouse monoclonal antibody,clone OTI6D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- ZKSCAN1