ZKSCAN1 Rabbit Polyclonal Antibody

CAT#: TA334001

Rabbit Polyclonal Anti-Zkscan1 Antibody

Product Images

WB Suggested Anti-Zkscan1 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Zkscan1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YECNECGKAFSQSSDLTKHQRIHTGEKPYECSECGKAFNRNSYLILHRRI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: zinc finger with KRAB and SCAN domains 1
• Database Link:
  NP_003430
  Entrez Gene 74570 Mouse
  UniProt ID P17029
• Background: Zkscan1 may be involved in transcriptional regulation.
• Synonyms: 9130423L19Rik; KOX18; PHZ-37; ZNF36; ZNF139; ZSCAN33
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Transcription Factors