ZKSCAN1 Rabbit Polyclonal Antibody

CAT#: TA342429

Rabbit Polyclonal Anti-ZKSCAN1 Antibody

Product Images

WB Suggested Anti-ZKSCAN1 Antibody Titration: 5.0 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZKSCAN1 antibody: synthetic peptide directed towards the N terminal of human ZKSCAN1. Synthetic peptide located within the following region: NTKEQILELLVLEQFLSILPKELQVWLQEYRPDSGEEAVTLLEDLELDLS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: zinc finger with KRAB and SCAN domains 1
• Database Link:
  NP_003430
  Entrez Gene 7586 Human
  UniProt ID P17029
• Background: The ZKSCAN1 gene encodes a transcriptional regulator of the KRAB (Kruppel-associated box) subfamily of zinc finger proteins, which contain repeated Cys2-His2 (C2H2) zinc finger domains that are connected by conserved sequences, called H/C links (summarized by Tommerup and Vissing, 1995 [PubMed 7557990]). Transcriptional regulatory proteins containing tandemly repeated zinc finger domains are thought to be involved in both normal and abnormal cellular proliferation and differentiation. See ZNF91 (MIM 603971) for general information on zinc finger proteins. [supplied by OMIM, Jul 2010]. Transcript Variant: This variant (3) differs in its 5' UTR, lacks a portion of the 5' coding region and initiates translation at a downstream in-frame start codon, compared to variant 1. The encoded isoform (c) is shorter at the N-terminus, compared to isoform a. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: AK091471.1, DA499270.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: 9130423L19Rik; KOX18; PHZ-37; ZNF36; ZNF139; ZSCAN33
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors