Rabbit Polyclonal Anti-ZNF213 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF213 antibody: synthetic peptide directed towards the N terminal of human ZNF213. Synthetic peptide located within the following region: ATGPPPTVGARRRPSVPQEQHSHSAQPPALLKEGRPGETTDTCFVSGVHG |
Rabbit Polyclonal Anti-ZNF213 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF213 antibody: synthetic peptide directed towards the middle region of human ZNF213. Synthetic peptide located within the following region: EWGTLDPAQRDLFWDIKRENSRNTTLGFGLKGQSEKSLLQEMVPVVPGQT |
Rabbit Polyclonal Anti-ZNF213 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF213 antibody: synthetic peptide directed towards the N terminal of human ZNF213. Synthetic peptide located within the following region: MAAPLEAQDQAPGEGEGLLIVKVEDSSWEQESAQHEDGRDSEACRQRFRQ |
Rabbit Polyclonal Anti-ZNF213 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF213 antibody: synthetic peptide directed towards the middle region of human ZNF213. Synthetic peptide located within the following region: SFSLRSYLLDHRRVHTGERPFGCGECDKSFKQRAHLIAHQSLHAKMAQPV |
Carrier-free (BSA/glycerol-free) ZNF213 mouse monoclonal antibody,clone OTI1A12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF213 mouse monoclonal antibody,clone OTI3D3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF213 mouse monoclonal antibody,clone OTI1H9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF213 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZNF213 |
ZNF213 mouse monoclonal antibody,clone OTI1A12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF213 mouse monoclonal antibody,clone OTI1A12, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF213 mouse monoclonal antibody,clone OTI1A12, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF213 mouse monoclonal antibody,clone OTI1A12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF213 mouse monoclonal antibody,clone OTI3D3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF213 mouse monoclonal antibody,clone OTI3D3, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF213 mouse monoclonal antibody,clone OTI3D3, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF213 mouse monoclonal antibody,clone OTI3D3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF213 mouse monoclonal antibody,clone OTI1H9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF213 mouse monoclonal antibody,clone OTI1H9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF213 mouse monoclonal antibody,clone OTI1H9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF213 mouse monoclonal antibody,clone OTI1H9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
