ZNF213 Rabbit Polyclonal Antibody

CAT#: TA343444

Rabbit Polyclonal Anti-ZNF213 Antibody

Product Images

WB Suggested Anti-ZNF213 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF213 antibody: synthetic peptide directed towards the N terminal of human ZNF213. Synthetic peptide located within the following region: MAAPLEAQDQAPGEGEGLLIVKVEDSSWEQESAQHEDGRDSEACRQRFRQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: zinc finger protein 213
• Database Link:
  NP_004211
  Entrez Gene 7760 Human
  UniProt ID O14771
• Background: ZNF213 contains three C2H2 zinc fingers, a Kruppel associated A box and a leucine rich motif (LeR domain/SCAN box), strongly suggestive of a transcription factor.C2H2 zinc finger proteins, such as ZNF213, have bipartite structures in which one domain binds DNA or RNA and the other modulates target gene expression. [supplied by OMIM]
• Synonyms: CR53; ZKSCAN21; ZSCAN53
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Horse: 93%; Pig: 92%; Mouse: 92%; Bovine: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors