ZNF213 Rabbit Polyclonal Antibody

CAT#: TA339091

Rabbit Polyclonal Anti-ZNF213 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ZNF213"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF213 antibody: synthetic peptide directed towards the middle region of human ZNF213. Synthetic peptide located within the following region: EWGTLDPAQRDLFWDIKRENSRNTTLGFGLKGQSEKSLLQEMVPVVPGQT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 51 kDa
Gene Name zinc finger protein 213
Background C2H2 zinc finger proteins, such as ZNF213, have bipartite structures in which one domain binds DNA or RNA and the other modulates target gene expression. [supplied by OMIM, Apr 2004]. Transcript Variant: This variant (2) uses an alternate donor splice site at the first exon, hence has a different 5' UTR compared to variant 1. Transcript variants 1 and 2 encode the same protein. ##Evidence-Data-START## Transcript exon combination :: AK289834.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025083, ERS025087 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Synonyms CR53; ZKSCAN21; ZSCAN53
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.