Rabbit Polyclonal Anti-ZNF564 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF564 antibody: synthetic peptide directed towards the C terminal of human ZNF564. Synthetic peptide located within the following region: GEKPYECKQCGKTFSYSSSFQRHERAHNGDKPYVKNVGKLSFITQPSNTC |
Rabbit Polyclonal Anti-ZNF564 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF564 antibody: synthetic peptide directed towards the N terminal of human ZNF564. Synthetic peptide located within the following region: KVFMHHSSLSRHIRSHLGHKPYDYQEYGEKPYKCKQCGKAFSSCQSFRRH |
Germany
Japan
United Kingdom
China