ZNF564 Rabbit Polyclonal Antibody

CAT#: TA341458

Rabbit Polyclonal Anti-ZNF564 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ZNF564"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF564 antibody: synthetic peptide directed towards the N terminal of human ZNF564. Synthetic peptide located within the following region: KVFMHHSSLSRHIRSHLGHKPYDYQEYGEKPYKCKQCGKAFSSCQSFRRH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 64 kDa
Gene Name zinc finger protein 564
Background May be involved in transcriptional regulation.
Synonyms FLJ38281; MGC26914
Note Immunogen Sequence Homology: Human: 100%; Dog: 83%; Bovine: 83%; Pig: 79%; Horse: 79%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.