ZNF564 Rabbit Polyclonal Antibody

CAT#: TA345512

Rabbit Polyclonal Anti-ZNF564 Antibody

Product Images

WB Suggested Anti-ZNF564 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF564 antibody: synthetic peptide directed towards the C terminal of human ZNF564. Synthetic peptide located within the following region: GEKPYECKQCGKTFSYSSSFQRHERAHNGDKPYVKNVGKLSFITQPSNTC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: zinc finger protein 564
• Database Link:
  NP_659413
  Entrez Gene 163050 Human
  UniProt ID Q8TBZ8
• Background: ZNF564 may be involved in transcriptional regulation.
• Synonyms: FLJ38281; MGC26914
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 92%; Zebrafish: 91%; Dog: 82%; Pig: 82%; Horse: 82%; Mouse: 82%; Bovine: 82%; Guinea pig: 75%

Reference Data

• Protein Families: Transcription Factors