Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-TRABID / ZRANB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KWLDRYRQIRPCTS, from the C Terminus of the protein sequence according to NP_060050.2. |
Rabbit Polyclonal Anti-ZRANB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZRANB1 antibody: synthetic peptide directed towards the C terminal of human ZRANB1. Synthetic peptide located within the following region: GAGANLNTDDDVTITFLPLVDSERKLLHVHFLSAQELGNEEQQEKLLREW |
Carrier-free (BSA/glycerol-free) ZRANB1 mouse monoclonal antibody,clone OTI2A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ZRANB1 mouse monoclonal antibody,clone OTI2A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZRANB1 mouse monoclonal antibody,clone OTI2A10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ZRANB1 mouse monoclonal antibody,clone OTI2A10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ZRANB1 mouse monoclonal antibody,clone OTI2A10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Active filters
Target Symbol
- ZRANB1