ZRANB1 Rabbit Polyclonal Antibody

CAT#: TA342580

Rabbit Polyclonal Anti-ZRANB1 Antibody

Product Images

WB Suggested Anti-ZRANB1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZRANB1 antibody: synthetic peptide directed towards the C terminal of human ZRANB1. Synthetic peptide located within the following region: GAGANLNTDDDVTITFLPLVDSERKLLHVHFLSAQELGNEEQQEKLLREW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 81 kDa
• Gene Name: zinc finger RANBP2-type containing 1
• Database Link:
  NP_060050
  Entrez Gene 54764 Human
  UniProt ID Q9UGI0
• Background: ZRANB1 is a positive regulator of the Wnt signaling pathway that specifically cleaves 'Lys-63'-linked ubiquitin chains.ZRANB1 acts by deubiquitinating APC protein, a negative regulator of Wnt-mediated transcription. ZRANB1 may also modulate TNF-alpha signaling.
• Synonyms: TRABID
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome