Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-ZYX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QQREKPRVQEKQH, from the internal region of the protein sequence according to NP_003452.1. |
Rabbit polyclonal Zyxin (Ser142) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Zyxin around the phosphorylation site of serine 142 (K-V-SP-S-I). |
| Modifications | Phospho-specific |
Anti-ZYX Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 300 amino acids of human zyxin |
Rabbit Polyclonal Anti-ZYX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZYX Antibody: synthetic peptide directed towards the middle region of human ZYX. Synthetic peptide located within the following region: GSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEV |
Rabbit Polyclonal Anti-ZYX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZYX Antibody: synthetic peptide directed towards the middle region of human ZYX. Synthetic peptide located within the following region: QPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPE |
ZYX rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZYX |
Zyxin Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human Zyxinin (NP_001010972.1). |
| Modifications | Unmodified |
ZYX Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Zyxin |
Active filters
Target Symbol
- ZYX