Zyxin (ZYX) Rabbit Polyclonal Antibody

CAT#: TA335775

Rabbit Polyclonal Anti-ZYX Antibody

Product Images

WB Suggested Anti-ZYX Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate

• 

  Sample Type: HeLa whole cell lysatePrimary Dilution: 1:200ZYX is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZYX Antibody: synthetic peptide directed towards the middle region of human ZYX. Synthetic peptide located within the following region: GSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: zyxin
• Database Link:
  NP_003452
  Entrez Gene 7791 Human
  UniProt ID Q15942
• Background: Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles.
• Synonyms: ESP-2; HED-2
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 92%; Pig: 92%; Rabbit: 92%; Guinea pig: 92%; Rat: 91%; Mouse: 85%; Bovine: 85%

Reference Data

• Protein Pathways: Focal adhesion