Rabbit polyclonal anti-ZNF192 antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ZNF192 antibody is generated from a rabbit immunized with a KLH conjugated synthetic peptide between 184-206 amino acids from the Central region of human ZNF192. |
Rabbit Polyclonal Anti-Zfp192 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for anti-Zfp192 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SQKPTPSQKGSSGDQEVTARLLTAGFQTLERIEDMAVSLIREEWLLDPSQ |
Rabbit Polyclonal Anti-ZNF192 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF192 Antibody: synthetic peptide directed towards the N terminal of human ZNF192. Synthetic peptide located within the following region: PSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPLGQEVFRLRFRQLRYQ |
Rabbit Polyclonal Anti-ZKSCAN8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF192 antibody: synthetic peptide directed towards the N terminal of human ZNF192. Synthetic peptide located within the following region: MAEESRKPSAPSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPLGQEVF |
Rabbit Polyclonal Anti-ZKSCAN8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF192 antibody: synthetic peptide directed towards the N terminal of human ZNF192. Synthetic peptide located within the following region: VHGHRVLWEEVVHSASAPEPPNTQLQSEATQHKSPVPQESQERAMSTSQS |
Rabbit Polyclonal Anti-ZNF192 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF192 antibody: synthetic peptide directed towards the N terminal of human ZNF192. Synthetic peptide located within the following region: MAEESRKPSAPSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPLGQEVF |
Rabbit Polyclonal Anti-ZNF192 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF192 antibody: synthetic peptide directed towards the middle region of human ZNF192. Synthetic peptide located within the following region: NGNTGLIQHLRIHTGEKPYQCNECGKAFIQRSSLIRHQRIHSGEKSESIS |
Germany
Japan
United Kingdom
China