Antibodies

View as table Download

ZNHIT3 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ZNHIT3

Rabbit Polyclonal Anti-ZNHIT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNHIT3 antibody: synthetic peptide directed towards the N terminal of human ZNHIT3. Synthetic peptide located within the following region: HKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRV

ZNHIT3 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ZNHIT3