Rabbit Polyclonal Anti-ZSCAN21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZSCAN21 antibody: synthetic peptide directed towards the C terminal of human ZSCAN21. Synthetic peptide located within the following region: AFNHSSNFNKHHRIHTGEKPYWCHHCGKTFCSKSNLSKHQRVHTGEGEAP |
Rabbit Polyclonal Anti-ZSCAN21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZSCAN21 antibody is: synthetic peptide directed towards the middle region of Human ZSCAN21. Synthetic peptide located within the following region: EALSQLRVLCCEWLRPEIHTKEQILELLVLEQFLTILPQELQAWVQEHCP |
Carrier-free (BSA/glycerol-free) ZSCAN21 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZSCAN21 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 130-280 of human ZSCAN21 (NP_666019.1). |
| Modifications | Unmodified |
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
5 Days
USD 420.00
5 Days
ZSCAN21 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
ZSCAN21 mouse monoclonal antibody,clone 2D8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
5 Days
ZSCAN21 mouse monoclonal antibody,clone 2D8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZSCAN21 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
USD 420.00
5 Days
Germany
Japan
United Kingdom
China
