Rabbit anti-ANXA2 (Annexin A2) polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | a 16 amino acid peptide from near the N terminal residues of human Annexin A2 protein |
Rabbit anti-ANXA2 (Annexin A2) polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | a 16 amino acid peptide from near the N terminal residues of human Annexin A2 protein |
Rabbit polyclonal ANXA2 (Phospho-Ser26) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ANXA2 around the phosphorylation site of serine 26. |
Modifications | Phospho-specific |
Goat Polyclonal Antibody against ERBB3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HSRLFPKANAQRT, from the C Terminus of the protein sequence according to NP_001973.2. |
Goat Polyclonal Antibody against Calretinin
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence STVHEILCKLSLEGD, from the N Terminus of the protein sequence according to NP_001002858.1; NP_004030.1; NP_001002857.1. |
Rabbit Polyclonal Anti-ANXA2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANXA2 antibody: synthetic peptide directed towards the C terminal of human ANXA2. Synthetic peptide located within the following region: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) ERBB3 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody,clone OTI1A6
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody,clone OTI1F1
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI3C1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody,clone OTI10D10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-ANXA2 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-ANXA2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-ERBB3 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) |
Anti-ERBB3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) |
ERBB3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERBB3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERBB3 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10), Biotinylated
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10), HRP conjugated
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERBB3 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
Applications | FC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERBB3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), Biotinylated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), HRP conjugated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERBB3 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERBB3 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERBB3 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERBB3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERBB3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERBB3 mouse monoclonal antibody,clone OTI1A6
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody,clone OTI1A6, Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody,clone OTI1A6, HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERBB3 mouse monoclonal antibody,clone OTI1A6
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERBB3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERBB3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERBB3 mouse monoclonal antibody,clone OTI1F1
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody,clone OTI1F1, Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
ERBB3 mouse monoclonal antibody,clone OTI1F1, HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |