Antibody Sample

cDNA Clones (24)
RNAi (11)
Gene Expression (6)
Antibodies (5)
Jump to Filters
View as table Download
FLASH (CASP8AP2) Rabbit Polyclonal Antibody
TA371349

USD 380.00

4 Weeks

CASP8AP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CASP8AP2
FLASH (CASP8AP2) Rabbit Polyclonal Antibody
TA306039

USD 430.00

In Stock

Rabbit Polyclonal FLASH Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen FLASH antibody was raised against a synthetic peptide corresponding to amino acids near the carboxy-terminus of human FLASH which differ from those of mouse by one amino acid.
FLASH (CASP8AP2) Rabbit Polyclonal Antibody
TA339709

USD 375.00

5 Days

Rabbit Polyclonal Anti-CASP8AP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CASP8AP2 antibody: synthetic peptide directed towards the N terminal of human CASP8AP2. Synthetic peptide located within the following region: SLKKNISALIKTARVEINRKDEEISNLHQRLSEFPHFRNNHKTARTFDTV
FLASH (CASP8AP2) Rabbit Polyclonal Antibody
TA351192

USD 345.00

In Stock

Rabbit Polyclonal Anti-CASP8AP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CASP8AP2
FLASH (CASP8AP2) Rabbit Polyclonal Antibody
TA374291

USD 220.00

3 Weeks

CASP8AP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1733-1982 of human CASP8AP2 (NP_036247.1).
Modifications Unmodified