KRAS mutant (L19F), Myc-DDK-tagged ORF clone of Homo sapiens v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog (KRAS), transcript variant b as transfection-ready DNA
| Mutation | L19F |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
KRAS mutant (Q22K), Myc-DDK-tagged ORF clone of Homo sapiens v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog (KRAS), transcript variant b as transfection-ready DNA
| Mutation | Q22K |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
KRAS (untagged)-Human v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog (KRAS), transcript variant a
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
TGFBR2 (untagged)-Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog (KRAS), transcript variant b
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TGFBR2 (untagged)-Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Lenti ORF clone of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
KRAS HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of v-Ha-ras Harvey rat sarcoma viral oncogene homolog (HRAS), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog (KRAS), transcript variant b, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
TGFBR2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
KRAS HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
HRAS HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
TGFBR2 (untagged)-Kinase deficient mutant (K277M) of Human transforming growth factor, beta receptor II (70/80kDa) (TGFBR2), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal TGF beta Receptor II (Ser225/250) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TGF β Receptor II around the phosphorylation site of serine 225/250 (D-R-SP-D-I). |
| Modifications | Phospho-specific |
Transient overexpression lysate of v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog (KRAS), transcript variant a
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
KRAS MS Standard C13 and N15-labeled recombinant protein (NP_004976)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression lysate of v-Ha-ras Harvey rat sarcoma viral oncogene homolog (HRAS), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal TGF beta Receptor II antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β Receptor II antibody. |
Rabbit Polyclonal Anti-TGFBR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TGFBR2 Antibody: synthetic peptide directed towards the N terminal of human TGFBR2. Synthetic peptide located within the following region: MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT |
Rabbit anti TGF beta Receptor II Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the internal sequence of human TGFbR2 |
KRAS (1-185, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
KRAS (1-185, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
KRAS (1-186, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
KRAS (1-186, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) KRAS mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRAS mouse monoclonal antibody, clone OTI3B12 (formerly 3B12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRAS mouse monoclonal antibody, clone OTI5H6 (formerly 5H6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRAS mouse monoclonal antibody, clone OTI4C6 (formerly 4C6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRAS mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRAS mouse monoclonal antibody, clone OTI4F6 (formerly 4F6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRAS mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRAS mouse monoclonal antibody, clone OTI8B4 (formerly 8B4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TGFBR2 mouse monoclonal antibody, clone OTI4F3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TGFBR2 MS Standard C13 and N15-labeled recombinant protein (NP_003233)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
KRAS MS Standard C13 and N15-labeled recombinant protein (NP_203524)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Germany
Japan
United Kingdom
China
