Fluorescent Protein Antibodies

Jump to Filters
View as table Download
Integrin alpha 4 (ITGA4) Rabbit Polyclonal Antibody
TA306659

USD 430.00

In Stock

Rabbit Polyclonal Integrin alpha 4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Integrin alpha 4 antibody was raised against a 15 amino acid peptide from near the center of human Integrin alpha 4.
Integrin alpha 6 (ITGA6) Rabbit Polyclonal Antibody
TA324731

USD 450.00

5 Days

Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6.
CD49b (ITGA2) Rabbit Polyclonal Antibody
TA338255

USD 375.00

5 Days

Rabbit Polyclonal Anti-ITGA2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF
Integrin alpha 4 (ITGA4) Rabbit Polyclonal Antibody
TA306654

USD 430.00

5 Days

Rabbit Polyclonal Integrin alpha 4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Integrin alpha 4 antibody was raised against a 16 amino acid peptide from near the center of human Integrin alpha 4.