Fluorescent Protein Antibodies

cDNA Clones (11)
Antibodies (3)
Proteins (3)
Jump to Filters
View as table Download
CD42b (GP1BA) (NM_000173) Human Tagged ORF Clone
RC206598

USD 98.00

USD 800.00

In Stock

GP1BA (Myc-DDK-tagged)-Human glycoprotein Ib (platelet), alpha polypeptide (GP1BA)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CD42b (GP1BA) (NM_000173) Human Tagged ORF Clone Lentiviral Particle
RC206598L1V

USD 820.00

3 Weeks

Lenti ORF particles, GP1BA (Myc-DDK tagged) - Human glycoprotein Ib (platelet), alpha polypeptide (GP1BA), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

CD42b (GP1BA) (NM_000173) Human Tagged ORF Clone Lentiviral Particle
RC206598L2V

USD 820.00

6 Weeks

Lenti ORF particles, GP1BA (mGFP-tagged) - Human glycoprotein Ib (platelet), alpha polypeptide (GP1BA), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

CD42b (GP1BA) (NM_000173) Human Tagged ORF Clone
RG206598

USD 460.00

In Stock

GP1BA (GFP-tagged) - Human glycoprotein Ib (platelet), alpha polypeptide (GP1BA)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD42b (GP1BA) (NM_000173) Human Tagged ORF Clone
RC206598L3

USD 620.00

3 Weeks

Lenti ORF clone of Human glycoprotein Ib (platelet), alpha polypeptide (GP1BA), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD42b (GP1BA) (NM_000173) Human Tagged ORF Clone Lentiviral Particle
RC206598L3V

USD 820.00

5 Weeks

Lenti ORF particles, GP1BA (Myc-DDK tagged) - Human glycoprotein Ib (platelet), alpha polypeptide (GP1BA), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

CD42b (GP1BA) (NM_000173) Human Tagged ORF Clone
RC206598L4

USD 620.00

3 Weeks

Lenti ORF clone of Human glycoprotein Ib (platelet), alpha polypeptide (GP1BA), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD42b (GP1BA) (NM_000173) Human Tagged ORF Clone Lentiviral Particle
RC206598L4V

USD 820.00

7 Weeks

Lenti ORF particles, GP1BA (mGFP-tagged) - Human glycoprotein Ib (platelet), alpha polypeptide (GP1BA), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

CD42b (GP1BA) (NM_000173) Human Untagged Clone
SC122550

USD 1,100.00

In Stock

GP1BA (untagged)-Human glycoprotein Ib (platelet), alpha polypeptide (GP1BA)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CD42b (GP1BA) (NM_000173) Human Tagged ORF Clone
RC206598L2

USD 620.00

3 Weeks

Lenti ORF clone of Human glycoprotein Ib (platelet), alpha polypeptide (GP1BA), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CD42b (GP1BA) (NM_000173) Human Over-expression Lysate
LC424885

USD 187.00

In Stock

GP1BA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
CD42b (GP1BA) Rabbit Polyclonal Antibody
TA339189

USD 375.00

5 Days

Rabbit Polyclonal Anti-GP1BA

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GP1BA antibody: synthetic peptide directed towards the C terminal of human GP1BA. Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS
CD42b (GP1BA) Rabbit Polyclonal Antibody
TA339190

USD 375.00

5 Days

Rabbit Polyclonal Anti-GP1BA

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GP1BA antibody is: synthetic peptide directed towards the middle region of Human GP1BA. Synthetic peptide located within the following region: TPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGS
CD42b (GP1BA) (NM_000173) Human Over-expression Lysate
LY424885

USD 605.00

5 Days

Transient overexpression lysate of glycoprotein Ib (platelet), alpha polypeptide (GP1BA)

Tag C-Myc/DDK
Expression Host HEK293T
CD42b (GP1BA) (NM_000173) Human Untagged Clone
SC318092

USD 1,100.00

3 Weeks

GP1BA (untagged)-Human glycoprotein Ib (platelet), alpha polypeptide (GP1BA)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CD42b (GP1BA) Rabbit Polyclonal Antibody
TA350034

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-GP1BA Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GP1BA
CD42b (GP1BA) Cytosection
TS406598P5

USD 889.00

4 Weeks

Transient overexpression of GP1BA (NM_000173) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack