Germany
Japan
United Kingdom
China
IL3RA (Myc-DDK-tagged)-Human interleukin 3 receptor, alpha (low affinity) (IL3RA)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Fluorescent Protein Antibodies
View as table Download
IL3RA (GFP-tagged) - Human interleukin 3 receptor, alpha (low affinity) (IL3RA)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, IL3RA (Myc-DDK tagged) - Human interleukin 3 receptor, alpha (low affinity) (IL3RA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF particles, IL3RA (mGFP-tagged) - Human interleukin 3 receptor, alpha (low affinity) (IL3RA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF clone of Human interleukin 3 receptor, alpha (low affinity) (IL3RA), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IL3RA (Myc-DDK tagged) - Human interleukin 3 receptor, alpha (low affinity) (IL3RA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF particles, IL3RA (mGFP-tagged) - Human interleukin 3 receptor, alpha (low affinity) (IL3RA), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
IL3RA (Myc-DDK tagged) - Homo sapiens interleukin 3 receptor, alpha (low affinity) (IL3RA), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL3RA (GFP-tagged) - Homo sapiens interleukin 3 receptor, alpha (low affinity) (IL3RA), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL3RA (untagged)-Human interleukin 3 receptor, alpha (low affinity) (IL3RA)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
IL3RA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of interleukin 3 receptor, alpha (low affinity) (IL3RA)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human interleukin 3 receptor, alpha (low affinity) (IL3RA), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal IL3RA Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL3RA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-348 amino acids from the C-terminal region of human IL3RA. |
Rabbit Polyclonal Anti-IL3RA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL3RA antibody is: synthetic peptide directed towards the middle region of Human IL3RA. Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS |
IL3RA MS Standard C13 and N15-labeled recombinant protein (NP_002174)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
IL3RA (untagged) - Homo sapiens interleukin 3 receptor, alpha (low affinity) (IL3RA), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
USD 420.00
2 Weeks
IL3RA mouse monoclonal antibody, clone OTI4A10
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
2 Weeks
IL3RA mouse monoclonal antibody, clone OTI1E12
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
2 Weeks
IL3RA mouse monoclonal antibody, clone OTI10D1
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
2 Weeks
IL3RA mouse monoclonal antibody, clone OTI10D4
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Purified recombinant protein of Human interleukin 3 receptor, alpha (low affinity) (IL3RA), Thr19-Arg305, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression of IL3RA (NM_002183) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- IL3RA
Families
- Transmembrane