Rabbit polyclonal anti-LTBR antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LTBR. |
Rabbit polyclonal anti-LTBR antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LTBR. |
LTBR HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Purified recombinant protein of Human lymphotoxin beta receptor (TNFR superfamily, member 3) (LTBR),Gln31-Met227, with N-terminal His tag, expressed in E. coli, 50ug
Tag | N-His |
Expression Host | E. coli |
LTBR / TNFR3 (28-227, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
Rabbit Polyclonal anti-LTBR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LTBR antibody is: synthetic peptide directed towards the N-terminal region of Human LTBR. Synthetic peptide located within the following region: VLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTY |
LTBR / TNFR3 (28-227, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) LTBR mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LTBR mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LTBR mouse monoclonal antibody, clone OTI3G10 (formerly 3G10), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
LTBR mouse monoclonal antibody, clone OTI3G10 (formerly 3G10), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
LTBR mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".