Fluorescent Protein Antibodies

Antibodies (7)
Proteins (4)
Jump to Filters
View as table Download
LTBR Rabbit Polyclonal Antibody
TA314162

USD 345.00

In Stock

Rabbit polyclonal anti-LTBR antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LTBR.
LTBR (NM_002342) Human Over-expression Lysate
LC400841

USD 99.00

In Stock

LTBR HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
LTBR (NM_002342) Human Recombinant Protein
TP762021

USD 215.00

In Stock

Purified recombinant protein of Human lymphotoxin beta receptor (TNFR superfamily, member 3) (LTBR),Gln31-Met227, with N-terminal His tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
LTBR / TNFR3 (28-227, His-tag) Human Protein
AR51717PU-S

USD 330.00

2 Weeks

LTBR / TNFR3 (28-227, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
LTBR Rabbit Polyclonal Antibody
TA329151

USD 375.00

5 Days

Rabbit Polyclonal anti-LTBR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LTBR antibody is: synthetic peptide directed towards the N-terminal region of Human LTBR. Synthetic peptide located within the following region: VLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTY
LTBR / TNFR3 (28-227, His-tag) Human Protein
AR51717PU-N

USD 845.00

2 Weeks

LTBR / TNFR3 (28-227, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
LTBR Mouse Monoclonal Antibody [Clone ID: OTI3G10]
CF805712

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LTBR mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)

Applications WB
Reactivities Human
Conjugation Unconjugated
LTBR Mouse Monoclonal Antibody [Clone ID: OTI3G10]
TA805712

USD 379.00

In Stock

LTBR mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)

Applications WB
Reactivities Human
Conjugation Unconjugated