SIGLEC6 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SIGLEC6 |
SIGLEC6 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SIGLEC6 |
Goat Anti-SIGLEC6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KWMKYGYTSSK, from the internal region of the protein sequence according to NP_001236.4; NP_942142.3; NP_942143.3. |
Rabbit Polyclonal anti-SIGLEC6 antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SIGLEC6 antibody: synthetic peptide directed towards the middle region of human SIGLEC6. Synthetic peptide located within the following region: FSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERT |
Rabbit Polyclonal Anti-SIGLEC6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SIGLEC6 |
SIGLEC6 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SIGLEC6 |