Coronavirus Research Products

View as table Download

Feline Coronavirus mouse monoclonal antibody, clone FIPV3-70, Purified

Applications ELISA, FC, IF, IHC, WB

Rabbit Polyclonal Anti-MASP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK

Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide corresponding to amino acids near the center of human ACE2. The immunogen is located within aa 180-230 of ACE2.

Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen ACE2 antibody was raised against synthetic peptide

Angiotensin Converting Enzyme 2 (ACE2) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen ACE2 antibody was raised against synthetic peptide

Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide corresponding to a sequence within the amino terminus of Human ACE2.