Feline Coronavirus mouse monoclonal antibody, clone FIPV3-70, Purified
Applications | ELISA, FC, IF, IHC, WB |
Feline Coronavirus mouse monoclonal antibody, clone FIPV3-70, Purified
Applications | ELISA, FC, IF, IHC, WB |
Rabbit Polyclonal Anti-MASP2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK |
Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide corresponding to amino acids near the center of human ACE2. The immunogen is located within aa 180-230 of ACE2. |
Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | ACE2 antibody was raised against synthetic peptide |
USD 440.00
2 Weeks
Angiotensin Converting Enzyme 2 (ACE2) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | ACE2 antibody was raised against synthetic peptide |
USD 475.00
2 Weeks
Angiotensin Converting Enzyme 2 (ACE2) (C-term) mouse monoclonal antibody, clone 11A31, Purified
Applications | IHC, WB |
Reactivities | Human |
Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide corresponding to a sequence within the amino terminus of Human ACE2. |