Rabbit Polyclonal IL-36RN Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | IL-36RN antibody was raised against a 19 amino acid peptide near the carboxy terminus of human IL-36RN. |
Rabbit Polyclonal IL-36RN Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | IL-36RN antibody was raised against a 19 amino acid peptide near the carboxy terminus of human IL-36RN. |
Rabbit polyclonal Anti-Il1f5 Antibody
Applications | WB |
Reactivities | Rat |
Immunogen | The immunogen for anti-Il1f5 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LGTKESKSFTFYRRDLGLTSSFESAAYPGWFLCTSPEADQPVRLTQISED |
Rabbit polyclonal Anti-IL1F5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL1F5 antibody: synthetic peptide directed towards the middle region of human IL1F5. Synthetic peptide located within the following region: LTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |