Research Areas

View as table Download

Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_001457.1.

Rabbit polyclonal anti-FZD2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD2.

Rabbit Polyclonal Anti-FZD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD2 antibody: synthetic peptide directed towards the N terminal of human FZD2. Synthetic peptide located within the following region: MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI

Frizzled 2 (FZD2) goat polyclonal antibody, Purified

Applications ELISA, IHC
Reactivities Bovine, Canine, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rat
Immunogen Synthetic peptide from the internal region of the human protein sequence according to NP_001457.1

Anti-FZD2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 188-200 amino acids of human frizzled family receptor 2

Frizzled 2 (FZD2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 533-563 amino acids from the C-terminal region of Human FZD2 / Frizzled-2

Rabbit Polyclonal Anti-FZD2 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen FSD2 / Frizzled 2 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human Frizzled 2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Platypus (100%); Opossum (95%); Turkey, Lizard, Newt (80%).

Anti-FZD2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 188-190 amino acids of human led family receptor 2