Research Areas

cDNA Clones (16)
Primary Antibodies (1)
Proteins (1)
Jump to Filters
View as table Download
CRIP2 Rabbit Polyclonal Antibody
TA335870

USD 375.00

5 Days

Rabbit Polyclonal Anti-CRIP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRIP2 Antibody: synthetic peptide directed towards the middle region of human CRIP2. Synthetic peptide located within the following region: TLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP