Germany
Japan
United Kingdom
China
CRIP2 (Myc-DDK-tagged)-Human cysteine-rich protein 2 (CRIP2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Research Areas
View as table Download
Crip2 (Myc-DDK-tagged) - Mouse cysteine rich protein 2 (Crip2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CRIP2 (GFP-tagged) - Human cysteine-rich protein 2 (CRIP2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Crip2 (GFP-tagged) - Mouse cysteine rich protein 2 (Crip2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CRIP2 (Myc-DDK tagged) - Homo sapiens cysteine-rich protein 2 (CRIP2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CRIP2 (Myc-DDK tagged) - Homo sapiens cysteine-rich protein 2 (CRIP2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CRIP2 (GFP-tagged) - Homo sapiens cysteine-rich protein 2 (CRIP2), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CRIP2 (GFP-tagged) - Homo sapiens cysteine-rich protein 2 (CRIP2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Crip2 (Myc-DDK-tagged ORF) - Rat cysteine-rich protein 2 (Crip2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Crip2 (untagged) - Mouse cysteine rich protein 2 (Crip2), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CRIP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CRIP2 Antibody: synthetic peptide directed towards the middle region of human CRIP2. Synthetic peptide located within the following region: TLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP |
CRIP2 (untagged)-Human cysteine-rich protein 2 (CRIP2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CRIP2 (untagged)-Human cysteine-rich protein 2 (CRIP2)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Crip2 (untagged ORF) - Rat cysteine-rich protein 2 (Crip2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of cysteine-rich protein 2 (CRIP2) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
CRIP2 (untagged) - Homo sapiens cysteine-rich protein 2 (CRIP2), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
CRIP2 (untagged) - Homo sapiens cysteine-rich protein 2 (CRIP2), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of CRIP2 (NM_001312) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CRIP2