Research Areas

Jump to Filters
View as table Download
TNF alpha (TNF) Rabbit Polyclonal Antibody
AP20373PU-N

USD 370.00

In Stock

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.
IL1 beta (IL1B) Rabbit Polyclonal Antibody
TA336742

USD 424.00

2 Weeks

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584]
IL1 Receptor I (IL1R1) Rabbit Polyclonal Antibody
TA324837

USD 450.00

In Stock

Rabbit polyclonal IL1R Antibody (C-term E487)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R.
IL1 beta (IL1B) Rabbit Polyclonal Antibody
AP20628PU-N

USD 370.00

2 Weeks

IL1 beta (IL1B) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 131-180 of Human IL-1 Beta
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA313322

USD 345.00

In Stock

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.
IL3RA Rabbit Polyclonal Antibody
TA350697

USD 345.00

In Stock

Rabbit Polyclonal Anti-IL3RA Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL3RA
TRADD (Center) Rabbit Polyclonal Antibody
AP54350PU-N

USD 450.00

2 Weeks

TRADD (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 133-159 amino acids from the Central region of human TRADD
IL1 beta (IL1B) Rabbit Polyclonal Antibody
TA326933

USD 275.00

3 Weeks

Rabbit anti-IL1B Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IL1B
TRAF2 Goat Polyclonal Antibody
TA302626

USD 375.00

5 Days

Goat Polyclonal Antibody against TRAF2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KMEAKNSYVRDD, from the C Terminus of the protein sequence according to NP_066961.2.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA319289

USD 1,380.00

5 Days

Rabbit polyclonal TNF Alpha antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA319290

USD 1,380.00

5 Days

Rabbit polyclonal TNF alpha antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA336738

USD 479.00

5 Days

Rabbit Polyclonal TNF-alpha Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]
IL3RA Rabbit Polyclonal Antibody
TA325019

USD 450.00

5 Days

Rabbit polyclonal IL3RA Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL3RA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-348 amino acids from the C-terminal region of human IL3RA.
IL3RA Rabbit Polyclonal Antibody
TA343332

USD 375.00

5 Days

Rabbit Polyclonal Anti-IL3RA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL3RA antibody is: synthetic peptide directed towards the middle region of Human IL3RA. Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS
IL1 beta (IL1B) Rabbit Polyclonal Antibody
TA321162

USD 345.00

In Stock

Anti-IL1B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
IL1 Receptor I (IL1R1) Rabbit Polyclonal Antibody
TA323543

USD 345.00

4 Weeks

Anti-IL1R1 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 209 amino acids of human interleukin 1 receptor, type I
IL1 Receptor I (IL1R1) Rabbit Polyclonal Antibody
TA323544

USD 345.00

4 Weeks

Anti-IL1R1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 209 amino acids of human interleukin 1 receptor, type I
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA323618

USD 345.00

In Stock

Anti-TNF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 57-233 amino acids of human tumor necrosis factor
IL1RAP Rabbit Polyclonal Antibody
TA324046

USD 335.00

4 Weeks

Anti-IL1RAP Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 22-356 amino acids of Human Interleukin-1 receptor accessory protein
IL1 Receptor I (IL1R1) Rabbit Polyclonal Antibody
TA358567

USD 360.00

5 Days

IL1R1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated