Research Areas

Jump to Filters
View as table Download
MASP2 Rabbit Polyclonal Antibody
TA346116

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-MASP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK
CD21 (CR2) (C-term) Rabbit Polyclonal Antibody
AP17240PU-N

USD 450.00

2 Weeks

CD21 (CR2) (C-term) rabbit polyclonal antibody

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 986-1014 amino acids from the C-terminal region of Human CR2.
CD46 Rabbit Polyclonal Antibody
TA324791

USD 450.00

5 Days

Rabbit polyclonal CD46 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD46 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 317-343 amino acids from the C-terminal region of human CD46.
CD46 Rabbit Polyclonal Antibody
TA349781

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-CD46 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CD46
CD21 (CR2) Rabbit Polyclonal Antibody
TA350811

USD 345.00

In Stock

Rabbit Polyclonal Anti-CR2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CR2