Germany
Japan
United Kingdom
China
IL18R1 (Myc-DDK-tagged)-Human interleukin 18 receptor 1 (IL18R1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Research Areas
View as table DownloadLenti-ORF clone of IL18R1 (mGFP-tagged)-Human interleukin 18 receptor 1 (IL18R1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IL18R1 (mGFP-tagged)-Human interleukin 18 receptor 1 (IL18R1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
IL18R1 (myc-DDK-tagged) - Human interleukin 18 receptor 1 (IL18R1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL18R1 (GFP-tagged) - Human interleukin 18 receptor 1 (IL18R1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL18R1 (untagged)-Human interleukin 18 receptor 1 (IL18R1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-IL18R1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL18R1 antibody: synthetic peptide directed towards the N terminal of human IL18R1. Synthetic peptide located within the following region: PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE |
Rabbit polyclonal anti-IL18R antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human IL18R. |
IL18R1 (GFP-tagged) - Human interleukin 18 receptor 1 (IL18R1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL18R1 (untagged) - Human interleukin 18 receptor 1 (IL18R1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Anti-IL18R1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 351-541 amino acids of human interleukin 18 receptor 1 |
Anti-IL18R1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 351-541 amino acids of human interleukin 18 receptor 1 |
Active filters
Target Symbol
- IL18R1
Families
- Transmembrane