WNT2B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
WNT2B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
WNT2B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, WNT2B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, WNT2B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, WNT2B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, WNT2B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
WNT2B (GFP-tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, WNT2B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WNT2B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WNT2B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WNT2B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
WNT2B (myc-DDK-tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
WNT2B (GFP-tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-WNT2B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Anti-WNT2B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Anti-WNT2B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT2B antibody: synthetic peptide directed towards the N terminal of human WNT2B. Synthetic peptide located within the following region: LRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLT |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
WNT2B (untagged)-Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
WNT2B (untagged)-Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
WNT2B Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
Conjugation | Unconjugated |
Immunogen | WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%). |
Rabbit Polyclonal Anti-WNT2B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT2B antibody: synthetic peptide directed towards the N terminal of human WNT2B. Synthetic peptide located within the following region: MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLL |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Purified recombinant protein of Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, Tyr250-Glu350, with N-terminal His tag, expressed in E.coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Transient overexpression lysate of wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
WNT2B Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
Immunogen | WNT2B antibody was raised against synthetic 14 amino acid peptide from near N-terminus of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Platypus (100%); Opossum, Chicken (86%). |
WNT2B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
WNT2B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
WNT2B (GFP-tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
WNT2B (untagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-WNT2B Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT2B |
Transient overexpression of WNT2B (NM_024494) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of WNT2B (NM_004185) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of WNT2B (NM_001291880) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug
Tag | N-GST and C-HIS |
Expression Host | E. coli |
Transient overexpression of WNT2B (NM_024494) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of WNT2B (NM_024494) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of WNT2B (NM_004185) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of WNT2B (NM_004185) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of WNT2B (NM_001291880) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack