Research Areas

cDNA Clones (6)
Antibodies (1)
Proteins (1)
Jump to Filters
View as table Download
G0 Protein alpha (GNAO1) (NM_020988) Human Tagged ORF Clone
RC217958

USD 420.00

In Stock

GNAO1 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
G0 Protein alpha (GNAO1) (NM_138736) Human Tagged ORF Clone
RG215437

USD 460.00

In Stock

GNAO1 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
G0 Protein alpha (GNAO1) (NM_020988) Human Tagged ORF Clone
RG217958

USD 460.00

In Stock

GNAO1 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
G0 Protein alpha (GNAO1) (NM_138736) Human Tagged ORF Clone
RC215437

USD 420.00

2 Weeks

GNAO1 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
G0 Protein alpha (GNAO1) (NM_020988) Human Untagged Clone
SC113061

USD 600.00

In Stock

GNAO1 (untagged)-Human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
G0 Protein alpha (GNAO1) (NM_138736) Human Untagged Clone
SC306072

USD 600.00

In Stock

GNAO1 (untagged)-Human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
G0 Protein alpha (GNAO1) Rabbit Polyclonal Antibody
TA333538

USD 375.00

5 Days

Rabbit Polyclonal Anti-GNAO1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GNAO1 Antibody: synthetic peptide directed towards the middle region of human GNAO1. Synthetic peptide located within the following region: CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL
G0 Protein alpha (GNAO1) Cytosection
TS417958P5

USD 889.00

4 Weeks

Transient overexpression of GNAO1 (NM_020988) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack