GNAO1 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GNAO1 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GNAO1 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GNAO1 (GFP-tagged) - Human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GNAO1 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GNAO1 (untagged)-Human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
GNAO1 (untagged)-Human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-GNAO1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GNAO1 Antibody: synthetic peptide directed towards the middle region of human GNAO1. Synthetic peptide located within the following region: CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL |
3`UTR clone of guanine nucleotide binding protein (G protein) alpha activating activity polypeptide O (GNAO1) transcript variant 1 for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
Transient overexpression of GNAO1 (NM_020988) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack