Germany
Japan
United Kingdom
China
WNT7B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 7B (WNT7B)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Research Areas
View as table Download
Wnt7b (GFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Wnt7b (GFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b) transcript variant 2, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, WNT7B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 7B (WNT7B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, WNT7B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 7B (WNT7B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Wnt7b (GFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b) transcript variant 1, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
WNT7B (GFP-tagged) - Human wingless-type MMTV integration site family, member 7B (WNT7B)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
WNT7B (untagged)-Human wingless-type MMTV integration site family, member 7B (WNT7B)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
WNT7B - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN407691 is the updated version of KN207691.
Wnt7b - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN519459 is the updated version of KN319459.
Lenti ORF clone of Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Wnt7b (mGFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt7b (GFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Wnt7b (mGFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt7b (GFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Wnt7b (mGFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt7b (GFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human wingless-type MMTV integration site family, member 7B (WNT7B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human wingless-type MMTV integration site family, member 7B (WNT7B), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, WNT7B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 7B (WNT7B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Wnt7b (Myc-DDK-tagged ORF) - Rat wingless-type MMTV integration site family, member 7B (Wnt7b), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Wnt7b (Myc-DDK-tagged ORF) - Rat wingless-type MMTV integration site family, member 7B (Wnt7b), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt7b (Myc-DDK-tagged ORF) - Rat wingless-type MMTV integration site family, member 7B (Wnt7b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Wnt7b (mGFP-tagged ORF) - Rat wingless-type MMTV integration site family, member 7B (Wnt7b), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Wnt7b (GFP-tagged ORF) - Rat wingless-type MMTV integration site family, member 7B (Wnt7b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Transient overexpression lysate of wingless-type MMTV integration site family, member 7B (WNT7B)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Wnt7b (untagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 1, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Wnt7b (untagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 2, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Wnt7b (untagged ORF) - Rat wingless-type MMTV integration site family, member 7B (Wnt7b), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-WNT7B Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
Wnt7b - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Wnt7b - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
WNT7B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 7B (WNT7B), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
qSTAR qPCR primer pairs against Homo sapiens gene WNT7B
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
WNT7B - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
WNT7B CRISPRa kit - CRISPR gene activation of human Wnt family member 7B
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Wnt7b CRISPRa kit - CRISPR gene activation of mouse wingless-type MMTV integration site family, member 7B
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene WNT7B
| Application | Plasmid of exact quantity for transcript copy number calculation |
WNT7B - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
WNT7B - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
WNT7B - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | RFP-BSD |
Active filters
Target Symbol
- WNT7B