WNT7B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 7B (WNT7B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
WNT7B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 7B (WNT7B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Wnt7b (GFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Wnt7b (GFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b) transcript variant 2, (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, WNT7B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 7B (WNT7B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, WNT7B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 7B (WNT7B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Wnt7b (GFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b) transcript variant 1, (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
WNT7B (GFP-tagged) - Human wingless-type MMTV integration site family, member 7B (WNT7B)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
WNT7B (untagged)-Human wingless-type MMTV integration site family, member 7B (WNT7B)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
WNT7B - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Wnt7b - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Lenti ORF clone of Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Wnt7b (mGFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Wnt7b (GFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Wnt7b (mGFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Wnt7b (GFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Wnt7b (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Wnt7b (mGFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Wnt7b (GFP-tagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 7B (WNT7B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 7B (WNT7B), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, WNT7B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 7B (WNT7B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Wnt7b (Myc-DDK-tagged ORF) - Rat wingless-type MMTV integration site family, member 7B (Wnt7b), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Wnt7b (Myc-DDK-tagged ORF) - Rat wingless-type MMTV integration site family, member 7B (Wnt7b), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Wnt7b (Myc-DDK-tagged ORF) - Rat wingless-type MMTV integration site family, member 7B (Wnt7b), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Wnt7b (mGFP-tagged ORF) - Rat wingless-type MMTV integration site family, member 7B (Wnt7b), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Wnt7b (GFP-tagged ORF) - Rat wingless-type MMTV integration site family, member 7B (Wnt7b), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of wingless-type MMTV integration site family, member 7B (WNT7B)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Wnt7b (untagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 1, (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Wnt7b (untagged) - Mouse wingless-related MMTV integration site 7B (Wnt7b), transcript variant 2, (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Wnt7b (untagged ORF) - Rat wingless-type MMTV integration site family, member 7B (Wnt7b), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-WNT7B Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
Wnt7b - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
Format | Retroviral plasmids |
Vector | pGFP-V-RS |
Wnt7b - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
WNT7B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human wingless-type MMTV integration site family, member 7B (WNT7B), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
qSTAR qPCR primer pairs against Homo sapiens gene WNT7B
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
WNT7B - human gene knockout kit via CRISPR, HDR mediated
Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
Donor DNA | GFP-puro |
WNT7B CRISPRa kit - CRISPR gene activation of human Wnt family member 7B
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Wnt7b CRISPRa kit - CRISPR gene activation of mouse wingless-type MMTV integration site family, member 7B
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene WNT7B
Application | Plasmid of exact quantity for transcript copy number calculation |
WNT7B - human gene knockout kit via CRISPR, HDR mediated
Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
Donor DNA | mBFP-Neo |
WNT7B - human gene knockout kit via CRISPR, HDR mediated
Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
Donor DNA | Luciferase-Puro |
WNT7B - human gene knockout kit via CRISPR, HDR mediated
Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
Donor DNA | RFP-BSD |