Products

View as table Download

FOXM1 Rabbit Polyclonal Antibody

Applications ChIP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FOXM1

Rabbit Polyclonal Anti-FOXM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXM1 antibody: synthetic peptide directed towards the middle region of human FOXM1. Synthetic peptide located within the following region: ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ

Rabbit Polyclonal Anti-FOXM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXM1 antibody: synthetic peptide directed towards the N terminal of human FOXM1. Synthetic peptide located within the following region: TSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAE

Rabbit Polyclonal Anti-FOXM1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXM1 antibody: synthetic peptide directed towards the middle region of human FOXM1. Synthetic peptide located within the following region: ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ

Rabbit Polyclonal anti-FOXM1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXM1 antibody: synthetic peptide directed towards the N terminal of human FOXM1. Synthetic peptide located within the following region: LKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA