Products

View as table Download

Rabbit Polyclonal SkiP Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SkiP antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human SkiP .

Rabbit Polyclonal Anti-SKIIP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SKIIP antibody: synthetic peptide directed towards the N terminal of human SKIIP. Synthetic peptide located within the following region: RQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALE

SNW1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SNW1

SNW1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-536 of human SNW1 (NP_036377.1).
Modifications Unmodified