Products

View as table Download

Carboxypeptidase B2 (CPB2) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected between 119~148 amino acids from the Center region of Human CPB2

Rabbit polyclonal anti-CPB2 antibody

Applications WB
Reactivities Human (Identities = 100%, Positives = 100%
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CPB2.

Rabbit Polyclonal Anti-CPB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CPB2 Antibody: synthetic peptide directed towards the middle region of human CPB2. Synthetic peptide located within the following region: RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI