Products

View as table Download

Rabbit Polyclonal Anti-Acin1 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Acin1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Acin1. Synthetic peptide located within the following region: RSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKAQEEPPAK

Rabbit Polyclonal Acinus Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Acinus antibody was raised against a 35 amino acid peptide near the center of human Acinus. The immunogen is located within amino acids 760 - 810 of Acinus.

Rabbit Polyclonal Acinus Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Acinus antibody was raised against a peptide corresponding to amino acids near the C-terminus of the cleaved active peptide p17, which are identical to those of mouse Acinus. The immunogen is located within amino acids 1050 - 1100 of Acinus.

Rabbit Polyclonal Acinus Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Acinus antibody was raised against a peptide corresponding to amino acids near the carbosy terminus of human AcinusL, which are identical to those of mouse Acinus.

Rabbit Polyclonal Acinus Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Acinus antibody was raised against a peptide corresponding to amino acids 994 to 1009 of human AcinusL, 267 to 282 of human AcinusS’, or 236 to 251 of human AcinusS, which are identical to those of mouse Acinus. The selected antigenic sequence is located near the N-terminus of active peptide p17.

Anti-ACIN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1065-1080 amino acids of human apoptotic chromatin condensation inducer 1

Anti-ACIN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1065-1080 amino acids of human apoptotic chromatin condensation inducer 1