Rabbit Polyclonal SkiP Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SkiP antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human SkiP . |
Rabbit Polyclonal SkiP Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SkiP antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human SkiP . |
Rabbit Polyclonal Anti-SKIIP Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SKIIP antibody: synthetic peptide directed towards the N terminal of human SKIIP. Synthetic peptide located within the following region: RQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALE |
SNW1 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 300-536 of human SNW1 (NP_036377.1). |
Modifications | Unmodified |