Products

View as table Download

Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IHC, IP, R, WB
Reactivities Human
Immunogen Acid Phosphatase isolated and purified from Human seminal plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Acid Phosphatase isolated and purified from Human seminal plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal Anti-ACPP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACPP antibody: synthetic peptide directed towards the middle region of human ACPP. Synthetic peptide located within the following region: CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV

Rabbit polyclonal antibody to ACPP (acid phosphatase, prostate)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 177 and 362 of Prostatic Acid Phosphatase

Anti-ACPP Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate

Anti-ACPP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate

Prostatic Acid Phosphatase (ACPP) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-300 of human Prostatic Acid Phosphatase (PAP/Prostatic Acid Phosphatase (ACPP)) (NP_001090.2).
Modifications Unmodified