Germany
Japan
United Kingdom
China
USD 820.00
3 Weeks
Lenti ORF particles, ACPP (Myc-DDK tagged) - Human acid phosphatase, prostate (ACPP), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Products
View as table DownloadUSD 820.00
6 Weeks
Lenti ORF particles, ACPP (mGFP-tagged) - Human acid phosphatase, prostate (ACPP), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ACPP (Myc-DDK-tagged)-Human acid phosphatase, prostate (ACPP), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 420.00
In Stock
ACPP (Myc-DDK-tagged)-Human acid phosphatase, prostate (ACPP), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 420.00
In Stock
ACPP (myc-DDK-tagged) - Human acid phosphatase, prostate (ACPP), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 460.00
In Stock
ACPP (GFP-tagged) - Human acid phosphatase, prostate (ACPP), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Acpp (Myc-DDK-tagged) - Mouse acid phosphatase, prostate (Acpp), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Acpp - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500748 is the updated version of KN300748.
Acpp (GFP-tagged) - Mouse acid phosphatase prostate (Acpp) transcript variant 1, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Acpp (GFP-tagged) - Mouse acid phosphatase prostate (Acpp) transcript variant 2, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Acpp (Myc-DDK-tagged) - Mouse acid phosphatase, prostate (Acpp), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acpp (Myc-DDK-tagged) - Mouse acid phosphatase, prostate (Acpp), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Acpp (mGFP-tagged) - Mouse acid phosphatase, prostate (Acpp), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acpp (GFP-tagged) - Mouse acid phosphatase, prostate (Acpp), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Acpp (Myc-DDK-tagged) - Mouse acid phosphatase, prostate (Acpp), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Acpp (Myc-DDK-tagged) - Mouse acid phosphatase, prostate (Acpp), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acpp (Myc-DDK-tagged) - Mouse acid phosphatase, prostate (Acpp), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Acpp (mGFP-tagged) - Mouse acid phosphatase, prostate (Acpp), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acpp (GFP-tagged) - Mouse acid phosphatase, prostate (Acpp), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human acid phosphatase, prostate (ACPP), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, ACPP (Myc-DDK tagged) - Human acid phosphatase, prostate (ACPP), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human acid phosphatase, prostate (ACPP), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, ACPP (mGFP-tagged) - Human acid phosphatase, prostate (ACPP), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti-ORF clone of ACPP (Myc-DDK-tagged)-Human acid phosphatase, prostate (ACPP), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, ACPP (Myc-DDK-tagged)-Human acid phosphatase, prostate (ACPP), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 620.00
3 Weeks
Lenti-ORF clone of ACPP (mGFP-tagged)-Human acid phosphatase, prostate (ACPP), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, ACPP (mGFP-tagged)-Human acid phosphatase, prostate (ACPP), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ACPP (GFP-tagged) - Human acid phosphatase, prostate (ACPP), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Acpp (Myc-DDK-tagged ORF) - Rat acid phosphatase, prostate (Acpp), transcript variant 1, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Acpp (Myc-DDK-tagged ORF) - Rat acid phosphatase, prostate (Acpp), transcript variant 1, (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acpp (Myc-DDK-tagged ORF) - Rat acid phosphatase, prostate (Acpp), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Acpp (mGFP-tagged ORF) - Rat acid phosphatase, prostate (Acpp), transcript variant 1, (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acpp (GFP-tagged ORF) - Rat acid phosphatase, prostate (Acpp), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Acpp (Myc-DDK-tagged ORF) - Rat acid phosphatase, prostate (Acpp), transcript variant 2, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Acpp (Myc-DDK-tagged ORF) - Rat acid phosphatase, prostate (Acpp), transcript variant 2, (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acpp (Myc-DDK-tagged ORF) - Rat acid phosphatase, prostate (Acpp), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Acpp (mGFP-tagged ORF) - Rat acid phosphatase, prostate (Acpp), transcript variant 2, (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acpp (GFP-tagged ORF) - Rat acid phosphatase, prostate (Acpp), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ACPP (untagged)-Human acid phosphatase, prostate (ACPP), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IHC, IP, R, WB |
| Reactivities | Human |
| Immunogen | Acid Phosphatase isolated and purified from Human seminal plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Acid Phosphatase isolated and purified from Human seminal plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
ACPP (untagged)-Human acid phosphatase, prostate (ACPP), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 380.00
2 Weeks
Acpp (untagged) - Mouse acid phosphatase, prostate (Acpp), transcript variant 1, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ACPP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACPP antibody: synthetic peptide directed towards the middle region of human ACPP. Synthetic peptide located within the following region: CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV |
USD 440.00
2 Weeks
Prostatic Acid Phosphatase (ACPP) mouse monoclonal antibody, clone M01010921, Purified
| Applications | ELISA, IHC, R |
| Reactivities | Human |
Lenti ORF clone of Human acid phosphatase, prostate (ACPP), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Acpp (Pain System Marker) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Mouse |
| Immunogen | Recombinant Mouse PAP protein was expressed using a baculoviral-delivery system. Preparation: After repeated injections, immune eggs were collected from laying hens, from which IgY antibody were prepared (“anti-PAP IgY fraction”). Some of this antibody was further purified using an agarose matrix to which the PAP protein was convalently attached (“Affinity-purified anti-PAP”). The final preparation in the accompanying vial contains 10 mg/ml of the “anti-PAP IgY fraction” supplemented with 20 mg/ml of the “affinity-purified anti-PAP” plus 50% (v/v) Glycerol (to prevent freezing at –20°C). Finally, this antibody preparation was filter-sterilized (0.45 mm) and 200 µl aliquots prepared. |
USD 215.00
In Stock
Purified recombinant protein of Human acid phosphatase, prostate (ACPP), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Active filters
Target Symbol
- ACPP