Products

View as table Download

Rabbit Polyclonal Antibody against MOP3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Bacterially expressed human MOP3 (C-terminus).

BMAL1 (ARNTL) (569-573) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Peptide sequence around aa.569~573 derived from Human BMAL1

Rabbit Polyclonal Antibody against BMAL

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Bacterially expressed human BMAL1

Rabbit Polyclonal Anti-ARNTL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF

BMAL1 (ARNTL) (569-573) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Peptide sequence around aa.569~573 derived from Human BMAL1

Rabbit Polyclonal Anti-ARNTL Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of mouse ARNTL. Synthetic peptide located within the following region: SGVDCNRKRKGSATDYQLDDFAFEESMDTDKDDPHGRLEYAEHQGRIKNA

Rabbit Polyclonal Anti-Arntl Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Arntl antibody is: synthetic peptide directed towards the C-terminal region of Mouse Arntl. Synthetic peptide located within the following region: GQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMS

Rabbit Polyclonal Anti-ARNTL Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ARNTL

ARNTL rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ARNTL

BMAL1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BMAL1.

BMAL1 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human BMAL1 around the non-acetylation site of Lys538. AA range:501-550