Products

Jump to Filters
View as table Download
SHARP1 (BHLHE41) Rabbit Polyclonal Antibody
TA347598

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-BHLHB3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BHLHB3 Antibody: A synthesized peptide derived from human BHLHB3
SHARP1 (BHLHE41) Rabbit Polyclonal Antibody
AP20458PU-N

USD 370.00

2 Weeks

SHARP1 (BHLHE41) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide around Lys31 of Human BHLHE41 / BHLHB3
SHARP1 (BHLHE41) Rabbit Polyclonal Antibody
TA336739

USD 424.00

5 Days

Rabbit Polyclonal DEC2/SHARP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human PAI1/Serpine 1 protein (between residues 1-75) [UniProt Q9C0J9]
SHARP1 (BHLHE41) Rabbit Polyclonal Antibody
TA333644

USD 375.00

5 Days

Rabbit Polyclonal Anti-BHLHB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-BHLHB3 Antibody: synthetic peptide directed towards the middle region of human BHLHB3. Synthetic peptide located within the following region: YCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTI
Bhlhe41 Rabbit Polyclonal Antibody
TA355619

USD 360.00

5 Days

Bhlhe41 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Bhlhe41 Rabbit Polyclonal Antibody
TA356049

USD 360.00

5 Days

Bhlhe41 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
SHARP1 (BHLHE41) Rabbit Polyclonal Antibody
TA374005

USD 220.00

3 Weeks

BHLHE41 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human BHLHE41 (NP_110389.1).
Modifications Unmodified